Total number of results for Alligator mississippiensis are 10
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00775 |
APAPSGGGSAPLAKIYPRGSHWAVGHLM
|
28 | Alligator mississippiensis | Bombesin/neuromedin-B/ranatensin | Gastrin-releasing peptide | 8101369#Wang Y, Conlon JM#Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator#Peptides 1993 May-Jun;14(3):573-9 | |
| NP02018 |
GWTLNSAGYLLGPHAIDNHRSFNEKHGIA
|
29 | Alligator mississippiensis | Galanin | Galanin | 7524049#Wang Y., Conlon J.M.; #Purification and primary structure of galanin from the alligator stomach.; #Peptides 15:603-606(1994). | |
| NP02288 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Alligator mississippiensis | Glucagon | Glucagon | ||
| NP02289 |
HSDAVFTDNYSRFRKQMAVKKYLNSVLT
|
28 | Alligator mississippiensis | Glucagon | Vasoactive intestinal peptide | 8101369#Wang Y., Conlon J.M.#Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator.# Peptides 14:573-579(1993). | |
| NP02516 |
EHWSYGLQPG
|
10 | Alligator mississippiensis | GnRH | GnRH I | 1882082#Lovejoy DA, Fischer WH, Parker DB, McRory JE, Park M, Lance V, Swanson P, Rivier JE, Sherwood NM#Primary structure of two forms of gonadotropin-releasing hormone from brains of the American alligator (Alligator mississippiensis)#Regul Pept 1991 Apr 25;33(2):105-16 | |
| NP02517 |
EHWSHGWYPG
|
10 | Alligator mississippiensis | GnRH | GnRH II | 1882082#Lovejoy DA, Fischer WH, Parker DB, McRory JE, Park M, Lance V, Swanson P, Rivier JE, Sherwood NM#Primary structure of two forms of gonadotropin-releasing hormone from brains of the American alligator (Alligator mississippiensis)#Regul Pept 1991 Apr 25;33(2):105-16 | |
| NP03758 |
ELHVNKARRPYIL
|
13 | Alligator mississippiensis | Neurotensin | Neurotensin | 8284256#Rodriguez-Bello A, Kah O, Tramu G, Conlon JM#Purification and primary structure of alligator neurotensin#Peptides 1993 Sep-Oct;14(5):1055-8 | |
| NP03843 |
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
|
36 | Alligator mississippiensis | NPY | Neuropeptide Y | 8101369#Wang Y., Conlon J.M.; #Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator.; #Peptides 14:573-579(1993).$8351403#Parker D.B., McRory J.E., Fischer W.H., Park M., Sherwood N.M.; #"Primary structure of neuropeptide Y from brains of the American alligator (Alligator mississippiensis)."; #Regul. Pept. 45:379-386(1993). | |
| NP05418 |
LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHNASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
|
199 | Alligator mississippiensis | Somatotropin/prolactin | Prolactin-1 | 1399264#Noso T., Swanson P., Lance V.A., Kawauchi H.#Isolation and characterization of glycosylated and non-glycosylated prolactins from alligator and crocodile.# Int. J. Pept. Protein Res. 39:250-257(1992). | |
| NP05419 |
LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
|
199 | Alligator mississippiensis | Somatotropin/prolactin | Prolactin-2 | 1399264#Noso T., Swanson P., Lance V.A., Kawauchi H.#Isolation and characterization of glycosylated and non-glycosylated prolactins from alligator and crocodile.# Int. J. Pept. Protein Res. 39:250-257(1992). |